Lineage for d5ovwk1 (5ovw K:24-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744091Domain d5ovwk1: 5ovw K:24-148 [341336]
    Other proteins in same PDB: d5ovwa_, d5ovwb_, d5ovwc_, d5ovwd_, d5ovwe_, d5ovwf_, d5ovwg2, d5ovwh2, d5ovwi2, d5ovwj2, d5ovwk2, d5ovwl2
    automated match to d4grwf_
    complexed with gol

Details for d5ovwk1

PDB Entry: 5ovw (more details), 2.65 Å

PDB Description: nanobody-bound btuf, the vitamin b12 binding protein in escherichia coli
PDB Compounds: (K:) Nanobody

SCOPe Domain Sequences for d5ovwk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ovwk1 b.1.1.1 (K:24-148) automated matches {Llama (Lama glama) [TaxId: 9844]}
mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
pvtvs

SCOPe Domain Coordinates for d5ovwk1:

Click to download the PDB-style file with coordinates for d5ovwk1.
(The format of our PDB-style files is described here.)

Timeline for d5ovwk1: