Lineage for d5ovwe_ (5ovw E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912356Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 2912385Protein automated matches [191053] (5 species)
    not a true protein
  7. 2912386Species Escherichia coli [TaxId:562] [330411] (2 PDB entries)
  8. 2912393Domain d5ovwe_: 5ovw E: [341334]
    Other proteins in same PDB: d5ovwg1, d5ovwg2, d5ovwh1, d5ovwh2, d5ovwi1, d5ovwi2, d5ovwj1, d5ovwj2, d5ovwk1, d5ovwk2, d5ovwl1, d5ovwl2
    automated match to d1n2za_
    complexed with gol

Details for d5ovwe_

PDB Entry: 5ovw (more details), 2.65 Å

PDB Description: nanobody-bound btuf, the vitamin b12 binding protein in escherichia coli
PDB Compounds: (E:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5ovwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ovwe_ c.92.2.2 (E:) automated matches {Escherichia coli [TaxId: 562]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

SCOPe Domain Coordinates for d5ovwe_:

Click to download the PDB-style file with coordinates for d5ovwe_.
(The format of our PDB-style files is described here.)

Timeline for d5ovwe_: