![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.2: TroA-like [53811] (6 proteins) |
![]() | Protein automated matches [191053] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [330411] (2 PDB entries) |
![]() | Domain d5ovwe_: 5ovw E: [341334] Other proteins in same PDB: d5ovwg1, d5ovwg2, d5ovwh1, d5ovwh2, d5ovwi1, d5ovwi2, d5ovwj1, d5ovwj2, d5ovwk1, d5ovwk2, d5ovwl1, d5ovwl2 automated match to d1n2za_ complexed with gol |
PDB Entry: 5ovw (more details), 2.65 Å
SCOPe Domain Sequences for d5ovwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ovwe_ c.92.2.2 (E:) automated matches {Escherichia coli [TaxId: 562]} aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna lsqvd
Timeline for d5ovwe_: