Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
Protein automated matches [190961] (16 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [341250] (2 PDB entries) |
Domain d5o96d2: 5o96 D:76-244 [341331] Other proteins in same PDB: d5o96a1, d5o96b1, d5o96c1, d5o96d1, d5o96e1, d5o96f1, d5o96g1, d5o96h1 automated match to d4e8ba2 protein/RNA complex; complexed with sam |
PDB Entry: 5o96 (more details), 2.3 Å
SCOPe Domain Sequences for d5o96d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o96d2 c.116.1.0 (D:76-244) automated matches {Legionella pneumophila [TaxId: 446]} resplkihlaqaiskgermemvmqksaelgvacitplitercqvkidkekmakkmhqwln iiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwrdypvqppdvalii gpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaaggdl
Timeline for d5o96d2: