Class b: All beta proteins [48724] (178 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (7 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [341248] (2 PDB entries) |
Domain d5o96d1: 5o96 D:2-75 [341330] Other proteins in same PDB: d5o96a2, d5o96b2, d5o96c2, d5o96d2, d5o96e2, d5o96f2, d5o96g2, d5o96h2 automated match to d4e8ba1 protein/RNA complex; complexed with sam |
PDB Entry: 5o96 (more details), 2.3 Å
SCOPe Domain Sequences for d5o96d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o96d1 b.122.1.0 (D:2-75) automated matches {Legionella pneumophila [TaxId: 446]} avrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkk kqvfvriasvlevn
Timeline for d5o96d1: