SCOPe 2.07: Domain d5o96d1: 5o96 D:2-75

Lineage for d5o96d1 (5o96 D:2-75)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (7 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [341248] (2 PDB entries)

8. Domain d5o96d1: 5o96 D:2-75 [341330]
   Other proteins in same PDB: d5o96a2, d5o96b2, d5o96c2, d5o96d2, d5o96e2, d5o96f2, d5o96g2, d5o96h2
   automated match to d4e8ba1
   protein/RNA complex; complexed with sam

Details for d5o96d1

PDB Entry: 5o96, 2.3 Å

PDB Description: structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam

PDB Compounds: (D:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d5o96d1:

Sequence; same for both SEQRES and ATOM records:

>d5o96d1 b.122.1.0 (D:2-75) automated matches {Legionella pneumophila [TaxId: 446]}
avrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkk
kqvfvriasvlevn

Timeline for d5o96d1:

• d5o96d1 first appeared in SCOPe 2.06
  
• d5o96d1 appears in the current release, SCOPe 2.08