SCOP 1.75: Domain d1atzb_: 1atz B:

Lineage for d1atzb_ (1atz B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53305] (4 PDB entries)

8. Domain d1atzb_: 1atz B: [34133]

Details for d1atzb_

PDB Entry: 1atz, 1.8 Å

PDB Description: human von willebrand factor a3 domain

PDB Compounds: (B:) von willebrand factor

SCOP Domain Sequences for d1atzb_:

Sequence; same for both SEQRES and ATOM records:

>d1atzb_ c.62.1.1 (B:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs

Timeline for d1atzb_:

• d1atzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1atzb_ appears in SCOP 1.73
  
• d1atzb_ appears in SCOPe 2.01
  
• d1atzb_ appears in the current release, SCOPe 2.08