Lineage for d6bi4a1 (6bi4 A:2-321)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2430460Species Bacillus anthracis [TaxId:198094] [189998] (3 PDB entries)
  8. 2430473Domain d6bi4a1: 6bi4 A:2-321 [341327]
    Other proteins in same PDB: d6bi4a2, d6bi4b2, d6bi4c2, d6bi4d2
    automated match to d2hunb_
    complexed with nad, ni, so4, suc

Details for d6bi4a1

PDB Entry: 6bi4 (more details), 2.91 Å

PDB Description: 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad.
PDB Compounds: (A:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d6bi4a1:

Sequence, based on SEQRES records: (download)

>d6bi4a1 c.2.1.0 (A:2-321) automated matches {Bacillus anthracis [TaxId: 198094]}
nilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgeiq
ngellehvikerdvqvivnfaaeshvdrsienpipfydtnvigtvtllelvkkyphiklv
qvstdevygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnny
gpyqypekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyni
ggnnektnvevveqiitllgktkkdieyvtdrlghdrryainaekmknefdwepkytfeq
glqetvqwyekneewwkplk

Sequence, based on observed residues (ATOM records): (download)

>d6bi4a1 c.2.1.0 (A:2-321) automated matches {Bacillus anthracis [TaxId: 198094]}
nilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgeiq
ngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdevyg
slgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqypekl
iplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnektnv
evveqiitllgktkkdieyvtdghdrryainaekmknefdwepkytfeqglqetvqwyek
neewwkplk

SCOPe Domain Coordinates for d6bi4a1:

Click to download the PDB-style file with coordinates for d6bi4a1.
(The format of our PDB-style files is described here.)

Timeline for d6bi4a1: