Lineage for d5ot0c_ (5ot0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911690Family c.88.1.0: automated matches [191606] (1 protein)
    not a true family
  6. 2911691Protein automated matches [191105] (6 species)
    not a true protein
  7. 2911718Species Thermococcus kodakarensis [TaxId:69014] [341313] (1 PDB entry)
  8. 2911721Domain d5ot0c_: 5ot0 C: [341319]
    automated match to d1wlsa_
    complexed with edo, pg4, po4

Details for d5ot0c_

PDB Entry: 5ot0 (more details), 2.18 Å

PDB Description: the thermostable l-asparaginase from thermococcus kodakarensis
PDB Compounds: (C:) L-asparaginase

SCOPe Domain Sequences for d5ot0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ot0c_ c.88.1.0 (C:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mkllvlgtggtiasaktemgykaalsaddilqlagirredgakietrdilnldstliqpe
dwvtigravfeafdeydgivithgtdtlaytssalsfmirnppipvvltgsmlpitepns
daprnlrtaltfarkgfpgiyvafmdkimlgtrvskvhslglnafqsinypdiayvkgde
vlvrhkprigngeplfdpeldpnvvhirltpglspevlravaratdgivlegygaggipy
rgrnllevvsetarekpvvmttqalyggvdltryevgrraleagvipagdmtkeatltkl
mwalghtrdleeirkimerniageitgs

SCOPe Domain Coordinates for d5ot0c_:

Click to download the PDB-style file with coordinates for d5ot0c_.
(The format of our PDB-style files is described here.)

Timeline for d5ot0c_: