Lineage for d5o44e_ (5o44 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932445Species House fly (Musca domestica) [TaxId:7370] [341246] (1 PDB entry)
  8. 2932447Domain d5o44e_: 5o44 E: [341312]
    Other proteins in same PDB: d5o44b_, d5o44c_, d5o44d_, d5o44f_
    automated match to d3wwqa_
    complexed with mg, so4

Details for d5o44e_

PDB Entry: 5o44 (more details), 3.14 Å

PDB Description: crystal structure of unbranched mixed tri-ubiquitin chain containing k48 and k63 linkages.
PDB Compounds: (E:) Ubiquitin

SCOPe Domain Sequences for d5o44e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o44e_ d.15.1.1 (E:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagcqledgrtlsdyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d5o44e_:

Click to download the PDB-style file with coordinates for d5o44e_.
(The format of our PDB-style files is described here.)

Timeline for d5o44e_: