SCOPe 2.07: Domain d5ovwb_: 5ovw B:

Lineage for d5ovwb_ (5ovw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.2: TroA-like [53811] (6 proteins)

6. Protein automated matches [191053] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [330411] (2 PDB entries)

8. Domain d5ovwb_: 5ovw B: [341309]
   Other proteins in same PDB: d5ovwg_, d5ovwh_, d5ovwi_, d5ovwj_, d5ovwk_, d5ovwl_
   automated match to d1n2za_
   complexed with gol

Details for d5ovwb_

PDB Entry: 5ovw, 2.65 Å

PDB Description: nanobody-bound btuf, the vitamin b12 binding protein in escherichia coli

PDB Compounds: (B:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5ovwb_:

Sequence; same for both SEQRES and ATOM records:

>d5ovwb_ c.92.2.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

Timeline for d5ovwb_:

• d5ovwb_ first appeared in SCOPe 2.06
  
• d5ovwb_ appears in the current release, SCOPe 2.08