Lineage for d5ompa3 (5omp A:254-424)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010940Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2010941Protein automated matches [191037] (12 species)
    not a true protein
  7. 2010966Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)
  8. 2010971Domain d5ompa3: 5omp A:254-424 [341308]
    Other proteins in same PDB: d5ompa1, d5ompa2
    automated match to d1kt1a1
    complexed with so4

Details for d5ompa3

PDB Entry: 5omp (more details), 1.88 Å

PDB Description: human fkbp5 protein
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d5ompa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ompa3 a.118.8.0 (A:254-424) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskase
sfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakgd
fekvlevnpqnkaarlqismcqkkakehnerdrriyanmfkkfaeqdakee

SCOPe Domain Coordinates for d5ompa3:

Click to download the PDB-style file with coordinates for d5ompa3.
(The format of our PDB-style files is described here.)

Timeline for d5ompa3: