Lineage for d5ompa2 (5omp A:139-253)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548640Protein automated matches [191209] (6 species)
    not a true protein
  7. 2548646Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries)
  8. 2548705Domain d5ompa2: 5omp A:139-253 [341307]
    Other proteins in same PDB: d5ompa3
    automated match to d1kt1a3
    complexed with so4

Details for d5ompa2

PDB Entry: 5omp (more details), 1.88 Å

PDB Description: human fkbp5 protein
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d5ompa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ompa2 d.26.1.1 (A:139-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedlfedggiirrtkrkgegysnpnegatveihlegrcggrmfdcrdvaftvgegedhdi
pigidkalekmqreeqcilylgprygfgeagkpkfgiepnaeliyevtlksfeka

SCOPe Domain Coordinates for d5ompa2:

Click to download the PDB-style file with coordinates for d5ompa2.
(The format of our PDB-style files is described here.)

Timeline for d5ompa2: