Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein automated matches [191209] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189839] (44 PDB entries) |
Domain d5ompa2: 5omp A:139-253 [341307] Other proteins in same PDB: d5ompa3 automated match to d1kt1a3 complexed with so4 |
PDB Entry: 5omp (more details), 1.88 Å
SCOPe Domain Sequences for d5ompa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ompa2 d.26.1.1 (A:139-253) automated matches {Human (Homo sapiens) [TaxId: 9606]} gedlfedggiirrtkrkgegysnpnegatveihlegrcggrmfdcrdvaftvgegedhdi pigidkalekmqreeqcilylgprygfgeagkpkfgiepnaeliyevtlksfeka
Timeline for d5ompa2: