Lineage for d5otbb1 (5otb B:3-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730730Species Goat (Capra hircus) [TaxId:9925] [341296] (4 PDB entries)
  8. 2730743Domain d5otbb1: 5otb B:3-195 [341300]
    automated match to d3uiva1
    complexed with peg, pge, pro

Details for d5otbb1

PDB Entry: 5otb (more details), 2.5 Å

PDB Description: structure of caprine serum albumin in p1 space group
PDB Compounds: (B:) Albumin

SCOPe Domain Sequences for d5otbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otbb1 a.126.1.0 (B:3-195) automated matches {Goat (Capra hircus) [TaxId: 9925]}
hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc
dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl
caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
tmrekvlassarq

SCOPe Domain Coordinates for d5otbb1:

Click to download the PDB-style file with coordinates for d5otbb1.
(The format of our PDB-style files is described here.)

Timeline for d5otbb1: