Lineage for d5o95c1 (5o95 C:2-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824274Species Legionella pneumophila [TaxId:446] [341248] (2 PDB entries)
  8. 2824277Domain d5o95c1: 5o95 C:2-75 [341285]
    Other proteins in same PDB: d5o95a2, d5o95b2, d5o95b3, d5o95c2, d5o95c3, d5o95d2
    automated match to d4e8ba1

Details for d5o95c1

PDB Entry: 5o95 (more details), 1.49 Å

PDB Description: structure of the putative methyltransferase lpg2936 from legionella pneumophila
PDB Compounds: (C:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d5o95c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o95c1 b.122.1.0 (C:2-75) automated matches {Legionella pneumophila [TaxId: 446]}
avrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkk
kqvfvriasvlevn

SCOPe Domain Coordinates for d5o95c1:

Click to download the PDB-style file with coordinates for d5o95c1.
(The format of our PDB-style files is described here.)

Timeline for d5o95c1: