Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (10 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [341248] (2 PDB entries) |
Domain d5o95c1: 5o95 C:2-75 [341285] Other proteins in same PDB: d5o95a2, d5o95b2, d5o95b3, d5o95c2, d5o95c3, d5o95d2 automated match to d4e8ba1 |
PDB Entry: 5o95 (more details), 1.49 Å
SCOPe Domain Sequences for d5o95c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o95c1 b.122.1.0 (C:2-75) automated matches {Legionella pneumophila [TaxId: 446]} avrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkk kqvfvriasvlevn
Timeline for d5o95c1: