Lineage for d6ehxb1 (6ehx B:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033353Domain d6ehxb1: 6ehx B:1-120 [341259]
    automated match to d3gizl1

Details for d6ehxb1

PDB Entry: 6ehx (more details), 2.2 Å

PDB Description: scfv abvance: increasing our knowledge of antibody structural space to enable faster and better decision making in drug discovery
PDB Compounds: (B:) scFv AbVance: increasing our knowledge of antibody structural space to enable faster and better decision making in drug discovery

SCOPe Domain Sequences for d6ehxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehxb1 b.1.1.0 (B:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesggglvkpgaslklsckasgytftsygmhwvrqapgkglewmggiipifgtany
nekvkgrftisrdkskstaylqlssltsedtavyycarapgysnayyfdywgqgtlvtvg

SCOPe Domain Coordinates for d6ehxb1:

Click to download the PDB-style file with coordinates for d6ehxb1.
(The format of our PDB-style files is described here.)

Timeline for d6ehxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ehxb2