![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
![]() | Protein automated matches [190961] (22 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:446] [341250] (2 PDB entries) |
![]() | Domain d5o95a2: 5o95 A:76-244 [341256] Other proteins in same PDB: d5o95a1, d5o95b1, d5o95b3, d5o95c1, d5o95c3, d5o95d1 automated match to d4e8ba2 |
PDB Entry: 5o95 (more details), 1.49 Å
SCOPe Domain Sequences for d5o95a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o95a2 c.116.1.0 (A:76-244) automated matches {Legionella pneumophila [TaxId: 446]} resplkihlaqaiskgermemvmqksaelgvacitplitercqvkidkekmakkmhqwln iiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwrdypvqppdvalii gpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaaggdl
Timeline for d5o95a2: