Lineage for d5o95d2 (5o95 D:76-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921467Species Legionella pneumophila [TaxId:446] [341250] (2 PDB entries)
  8. 2921471Domain d5o95d2: 5o95 D:76-244 [341251]
    Other proteins in same PDB: d5o95a1, d5o95b1, d5o95b3, d5o95c1, d5o95c3, d5o95d1
    automated match to d4e8ba2

Details for d5o95d2

PDB Entry: 5o95 (more details), 1.49 Å

PDB Description: structure of the putative methyltransferase lpg2936 from legionella pneumophila
PDB Compounds: (D:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d5o95d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o95d2 c.116.1.0 (D:76-244) automated matches {Legionella pneumophila [TaxId: 446]}
resplkihlaqaiskgermemvmqksaelgvacitplitercqvkidkekmakkmhqwln
iiigaceqcgrnqipelrqpvyldqfvreakehlklilhpafsktwrdypvqppdvalii
gpeggfsdeeirltsghgflplslgprvlrtetaaitalsvlqaaggdl

SCOPe Domain Coordinates for d5o95d2:

Click to download the PDB-style file with coordinates for d5o95d2.
(The format of our PDB-style files is described here.)

Timeline for d5o95d2: