SCOPe 2.08: Domain d6b0gc1: 6b0g C:1-106

Lineage for d6b0gc1 (6b0g C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6b0gc1: 6b0g C:1-106 [341241]
   Other proteins in same PDB: d6b0gc2
   automated match to d1dn0a1
   complexed with gol

Details for d6b0gc1

PDB Entry: 6b0g, 1.9 Å

PDB Description: crystal structure of pfs25 in complex with the transmission blocking antibody 1245

PDB Compounds: (C:) 1245 Antibody, Light Chain

SCOPe Domain Sequences for d6b0gc1:

Sequence; same for both SEQRES and ATOM records:

>d6b0gc1 b.1.1.0 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqsplslpvtlgqpasiscrssqslvysdgntylswfqqrpgqsprrliykvsnrd
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqdthwpptfgggtkvei

Timeline for d6b0gc1:

• d6b0gc1 first appeared in SCOPe 2.06
  
• d6b0gc1 appears in SCOPe 2.07