![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (7 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries) |
![]() | Domain d5l8rb_: 5l8r B: [341237] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_ automated match to d4xk8b_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rb_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} alrfprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt sgnlfhvawqgnfeawvqdplhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg lfgvsslawaghlvhvaipgsrgeyvrwnnflsvlphpqglgplftgqwnlyaqnpdssn hlfstsqgagtailtllggfhpqtqslwltdmahhhlaiailfligghmyrtnfgighsi kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi aqdfttqaalythhqyiagfimtgafahgaiffirdynpeqnadnvlarmlehkeaiish lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst nspalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl wqgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty aafliastsgkfg
Timeline for d5l8rb_: