Lineage for d6elll2 (6ell L:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750451Domain d6elll2: 6ell L:107-213 [341232]
    Other proteins in same PDB: d6ella_, d6ellb1, d6ellh_, d6elll1
    automated match to d1dn0a2

Details for d6elll2

PDB Entry: 6ell (more details), 1.9 Å

PDB Description: fab fragment. abvance: increasing our knowledge of antibody structural space to enable faster and better decision making in antibody drug discovery
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6elll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elll2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6elll2:

Click to download the PDB-style file with coordinates for d6elll2.
(The format of our PDB-style files is described here.)

Timeline for d6elll2: