![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d6eljl1: 6elj L:1-106 [341229] Other proteins in same PDB: d6elja_, d6eljb2, d6eljh_, d6eljl2 automated match to d1dn0a1 |
PDB Entry: 6elj (more details), 1.9 Å
SCOPe Domain Sequences for d6eljl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eljl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytsrlhsgvps rfsgsgsgtdftftisslqpediatyycqqgstlpftfgqgtklei
Timeline for d6eljl1:
![]() Domains from other chains: (mouse over for more information) d6elja_, d6eljb1, d6eljb2, d6eljh_ |