SCOPe 2.08: Domain d5jqda1: 5jqd A:1-107

Lineage for d5jqda1 (5jqd A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5jqda1: 5jqd A:1-107 [341226]
   Other proteins in same PDB: d5jqda2, d5jqdb2, d5jqdc_, d5jqdd_
   automated match to d1dn0a1

Details for d5jqda1

PDB Entry: 5jqd, 2.59 Å

PDB Description: antibody fab fragment

PDB Compounds: (A:) D80 Fab Fragment Light Chain

SCOPe Domain Sequences for d5jqda1:

Sequence; same for both SEQRES and ATOM records:

>d5jqda1 b.1.1.1 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttvei

Timeline for d5jqda1:

• d5jqda1 first appeared in SCOPe 2.06
  
• d5jqda1 appears in SCOPe 2.07