Lineage for d5jqdb1 (5jqd B:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743360Domain d5jqdb1: 5jqd B:1-107 [341222]
    Other proteins in same PDB: d5jqda2, d5jqdb2, d5jqdc_, d5jqdd_
    automated match to d1dn0a1

Details for d5jqdb1

PDB Entry: 5jqd (more details), 2.59 Å

PDB Description: antibody fab fragment
PDB Compounds: (B:) D80 Fab Fragment Light Chain

SCOPe Domain Sequences for d5jqdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqdb1 b.1.1.1 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttvei

SCOPe Domain Coordinates for d5jqdb1:

Click to download the PDB-style file with coordinates for d5jqdb1.
(The format of our PDB-style files is described here.)

Timeline for d5jqdb1: