Lineage for d5h52a1 (5h52 A:3-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915586Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)
  8. 2915638Domain d5h52a1: 5h52 A:3-333 [341220]
    automated match to d1jw1a1
    complexed with 4ti, cit, mli

Details for d5h52a1

PDB Entry: 5h52 (more details), 3 Å

PDB Description: structure of titanium-bound human serum transferrin
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d5h52a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h52a1 c.94.1.0 (A:3-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtcpe

SCOPe Domain Coordinates for d5h52a1:

Click to download the PDB-style file with coordinates for d5h52a1.
(The format of our PDB-style files is described here.)

Timeline for d5h52a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h52a2