Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries) |
Domain d5l8r2_: 5l8r 2: [341208] Other proteins in same PDB: d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_ automated match to d4y282_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8r2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8r2_ f.43.1.0 (2:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} tvaepdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlga agifipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcv ntdpifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawf qhiytgtgpidnlfahladpghatifaa
Timeline for d5l8r2_: