Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
Protein automated matches [276198] (5 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries) |
Domain d5l8rj_: 5l8r J: [341205] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rl_ automated match to d4y28j_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mrdlktylsvapvastlwfaalagllieinrffpdaltfpff
Timeline for d5l8rj_: