SCOPe 2.08: Domain d5hwlb2: 5hwl B:85-217

Lineage for d5hwlb2 (5hwl B:85-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
   Uniprot P09488 P28161

8. Domain d5hwlb2: 5hwl B:85-217 [341202]
   Other proteins in same PDB: d5hwla1, d5hwlb1
   automated match to d1xw5a1
   complexed with gsh, nne

Details for d5hwlb2

PDB Entry: 5hwl, 1.6 Å

PDB Description: human glutathione s-transferase mu2 complexed with bdea, monoclinic crystal form

PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d5hwlb2:

Sequence; same for both SEQRES and ATOM records:

>d5hwlb2 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

Timeline for d5hwlb2:

• d5hwlb2 first appeared in SCOPe 2.06
  
• d5hwlb2 appears in SCOPe 2.07