SCOPe 2.08: Domain d6ehyb2: 6ehy B:138-245

Lineage for d6ehyb2 (6ehy B:138-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6ehyb2: 6ehy B:138-245 [341190]
   automated match to d4f9lc1

Details for d6ehyb2

PDB Entry: 6ehy, 2.25 Å

PDB Description: scfv abvance: increasing our knowledge of antibody structural space to enable faster and better decision making in drug discovery

PDB Compounds: (B:) scFv antibody fragment

SCOPe Domain Sequences for d6ehyb2:

Sequence; same for both SEQRES and ATOM records:

>d6ehyb2 b.1.1.0 (B:138-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdiqmtqspstlsasigdrvtitcrasegiyhwlawyqqkpgkapklliykasslasgap
srfsgsgsgtdftltisslqpddfatyycqqysnypltfgggtkleik

Timeline for d6ehyb2:

• d6ehyb2 first appeared in SCOPe 2.06
  
• d6ehyb2 appears in SCOPe 2.07