Lineage for d5l8rf_ (5l8r F:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254598Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2254606Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 2254607Protein automated matches [276199] (2 species)
    not a true protein
  7. 2254608Species Pea (Pisum sativum) [TaxId:3888] [276202] (3 PDB entries)
  8. 2254609Domain d5l8rf_: 5l8r F: [341186]
    Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rj_
    automated match to d4rkuf_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8rf_

PDB Entry: 5l8r (more details), 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (F:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d5l8rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8rf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatrlvfrgfswpiaayrellngelvakdv

SCOPe Domain Coordinates for d5l8rf_:

Click to download the PDB-style file with coordinates for d5l8rf_.
(The format of our PDB-style files is described here.)

Timeline for d5l8rf_: