![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
![]() | Protein automated matches [276199] (2 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276202] (3 PDB entries) |
![]() | Domain d5l8rf_: 5l8r F: [341186] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rj_ automated match to d4rkuf_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii idvplatrlvfrgfswpiaayrellngelvakdv
Timeline for d5l8rf_: