Lineage for d5l8re1 (5l8r E:66-129)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helixSuperfamily b.34.4: Electron transport accessory proteins [50090] (5 families) 
Family b.34.4.0: automated matches [191659] (1 protein)
not a true familyProtein automated matches [191237] (6 species)
not a true protein
Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries) 
Domain d5l8re1: 5l8r E:66-129 [341185]
Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re2, d5l8rf_, d5l8rj_
automated match to d4y28e_
complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex
Details for d5l8re1
PDB Entry: 5l8r (more details), 2.6 Å
PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (E:) Putative uncharacterized proteinSCOPe Domain Sequences for d5l8re1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8re1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
eevk
SCOPe Domain Coordinates for d5l8re1:
Click to download the PDB-style file with coordinates for d5l8re1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5l8re1:
View in 3D
