Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (6 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries) |
Domain d5l8re1: 5l8r E:66-129 [341185] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re2, d5l8rf_, d5l8rj_ automated match to d4y28e_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8re1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8re1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]} igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev eevk
Timeline for d5l8re1: