SCOPe 2.08: Domain d5l8re1: 5l8r E:66-129

Lineage for d5l8re1 (5l8r E:66-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [311431] (8 PDB entries)

8. Domain d5l8re1: 5l8r E:66-129 [341185]
   Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_
   automated match to d4y28e_
   complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8re1

PDB Entry: 5l8r, 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.

PDB Compounds: (E:) Putative uncharacterized protein

SCOPe Domain Sequences for d5l8re1:

Sequence; same for both SEQRES and ATOM records:

>d5l8re1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
eevk

Timeline for d5l8re1:

• d5l8re1 first appeared in SCOPe 2.06
  
• d5l8re1 appears in SCOPe 2.07