Lineage for d6b9xb1 (6b9x B:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211247Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2211248Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2211279Protein automated matches [190414] (3 species)
    not a true protein
  7. 2211289Species Human (Homo sapiens) [TaxId:9606] [187290] (9 PDB entries)
  8. 2211290Domain d6b9xb1: 6b9x B:1-125 [341184]
    Other proteins in same PDB: d6b9xb2
    automated match to d1szva_

Details for d6b9xb1

PDB Entry: 6b9x (more details), 1.42 Å

PDB Description: crystal structure of ragulator
PDB Compounds: (B:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d6b9xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9xb1 d.110.7.1 (B:1-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qvaas

SCOPe Domain Coordinates for d6b9xb1:

Click to download the PDB-style file with coordinates for d6b9xb1.
(The format of our PDB-style files is described here.)

Timeline for d6b9xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b9xb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b9xc_