Lineage for d6b9xc_ (6b9x C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971097Protein automated matches [190414] (3 species)
    not a true protein
  7. 2971107Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2971109Domain d6b9xc_: 6b9x C: [341181]
    Other proteins in same PDB: d6b9xb2
    automated match to d1veta_

Details for d6b9xc_

PDB Entry: 6b9x (more details), 1.42 Å

PDB Description: crystal structure of ragulator
PDB Compounds: (C:) Ragulator complex protein LAMTOR3

SCOPe Domain Sequences for d6b9xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9xc_ d.110.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv
e

SCOPe Domain Coordinates for d6b9xc_:

Click to download the PDB-style file with coordinates for d6b9xc_.
(The format of our PDB-style files is described here.)

Timeline for d6b9xc_: