![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
![]() | Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [53298] (3 PDB entries) |
![]() | Domain d1dkua1: 1dku A:8-166 [34118] complexed with abm, ap2 |
PDB Entry: 1dku (more details), 2.2 Å
SCOPe Domain Sequences for d1dkua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat rvialdlhapqiqgffdipidhlmgvpilgeyfegknle
Timeline for d1dkua1: