Lineage for d1dkrb2 (1dkr B:167-315)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25845Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 25846Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 25974Family c.61.1.2: Phosphoribosylpyrophosphate synthetase [53296] (1 protein)
  6. 25975Protein Phosphoribosylpyrophosphate synthetase [53297] (1 species)
  7. 25976Species Bacillus subtilis [TaxId:1423] [53298] (2 PDB entries)
  8. 25980Domain d1dkrb2: 1dkr B:167-315 [34117]

Details for d1dkrb2

PDB Entry: 1dkr (more details), 2.3 Å

PDB Description: crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.

SCOP Domain Sequences for d1dkrb2:

Sequence, based on SEQRES records: (download)

>d1dkrb2 c.61.1.2 (B:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis}
divivspdhggvtrarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddii
dtagtitlaanalvengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekki
erfkqlsvgpllaeaiirvheqqsvsylf

Sequence, based on observed residues (ATOM records): (download)

>d1dkrb2 c.61.1.2 (B:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis}
divivspdhggvtrarkladrlkapiaiidkrmnivgniegktailiddiidtagtitla
analvengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvg
pllaeaiirvheqqsvsylf

SCOP Domain Coordinates for d1dkrb2:

Click to download the PDB-style file with coordinates for d1dkrb2.
(The format of our PDB-style files is described here.)

Timeline for d1dkrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkrb1