SCOPe 2.06: Domain d1dkrb1: 1dkr B:1-166

Lineage for d1dkrb1 (1dkr B:1-166)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [53298] (3 PDB entries)

8. Domain d1dkrb1: 1dkr B:1-166 [34116]
   complexed with so4

Details for d1dkrb1

PDB Entry: 1dkr, 2.3 Å

PDB Description: crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.

PDB Compounds: (B:) phosphoribosyl pyrophosphate synthetase

SCOPe Domain Sequences for d1dkrb1:

Sequence; same for both SEQRES and ATOM records:

>d1dkrb1 c.61.1.2 (B:1-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
snqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyi
iqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanl
letagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknle

Timeline for d1dkrb1:

• d1dkrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dkrb1 appears in SCOPe 2.05
  
• d1dkrb1 appears in SCOPe 2.07
  
• d1dkrb1 appears in the current release, SCOPe 2.08