Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species) |
Species Bacillus subtilis [TaxId:1423] [53298] (3 PDB entries) |
Domain d1dkrb1: 1dkr B:1-166 [34116] complexed with so4 |
PDB Entry: 1dkr (more details), 2.3 Å
SCOPe Domain Sequences for d1dkrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkrb1 c.61.1.2 (B:1-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} snqygdknlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyi iqstsdpvnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanl letagatrvialdlhapqiqgffdipidhlmgvpilgeyfegknle
Timeline for d1dkrb1: