Lineage for d5tpqb1 (5tpq B:9-449)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479285Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2479286Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2479287Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2479288Protein Alkaline phosphatase [53651] (4 species)
  7. 2479296Species Escherichia coli [TaxId:562] [53652] (44 PDB entries)
  8. 2479384Domain d5tpqb1: 5tpq B:9-449 [341149]
    Other proteins in same PDB: d5tpqa2, d5tpqb2
    automated match to d1alka_
    complexed with po4, zn; mutant

Details for d5tpqb1

PDB Entry: 5tpq (more details), 2.45 Å

PDB Description: e. coli alkaline phosphatase d101a, d153a, r166s, e322a, k328a mutant
PDB Compounds: (B:) alkaline phosphatase

SCOPe Domain Sequences for d5tpqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpqb1 c.76.1.1 (B:9-449) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
ggffkgidalpltgqythyalnkktgkpdyvtasaasatawstgvktyngalgvdihekd
hptilemakaaglatgnvstaelqaatpaalvahvtsskcygpsatsekcpgnalekggk
gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
llsknekgfflqvagasidaqdhaanpcgqigetvdldeavqralefakkegntlvivta
dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
vvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d5tpqb1:

Click to download the PDB-style file with coordinates for d5tpqb1.
(The format of our PDB-style files is described here.)

Timeline for d5tpqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tpqb2