![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5xjea1: 5xje A:232-339 [341147] Other proteins in same PDB: d5xjec1, d5xjec2 automated match to d1hzhk3 complexed with cl |
PDB Entry: 5xje (more details), 2.4 Å
SCOPe Domain Sequences for d5xjea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjea1 b.1.1.2 (A:232-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d5xjea1:
![]() Domains from other chains: (mouse over for more information) d5xjeb1, d5xjeb2, d5xjec1, d5xjec2 |