Lineage for d5xz0b2 (5xz0 B:122-236)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541681Protein automated matches [226944] (2 species)
    not a true protein
  7. 2541687Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries)
  8. 2541692Domain d5xz0b2: 5xz0 B:122-236 [341144]
    Other proteins in same PDB: d5xz0a1, d5xz0b1
    automated match to d3gp7b2
    mutant

Details for d5xz0b2

PDB Entry: 5xz0 (more details), 3 Å

PDB Description: staphylococcal enterotoxin b (seb) mutant s19 - n23a, y90a, r110a and f177a
PDB Compounds: (B:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d5xz0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xz0b2 d.15.6.1 (B:122-236) automated matches {Staphylococcus aureus [TaxId: 93062]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt

SCOPe Domain Coordinates for d5xz0b2:

Click to download the PDB-style file with coordinates for d5xz0b2.
(The format of our PDB-style files is described here.)

Timeline for d5xz0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xz0b1