![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein automated matches [226944] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries) |
![]() | Domain d5xz0a2: 5xz0 A:122-236 [341140] Other proteins in same PDB: d5xz0a1, d5xz0b1 automated match to d3gp7b2 mutant |
PDB Entry: 5xz0 (more details), 3 Å
SCOPe Domain Sequences for d5xz0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xz0a2 d.15.6.1 (A:122-236) automated matches {Staphylococcus aureus [TaxId: 93062]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
Timeline for d5xz0a2: