Lineage for d5xz0a1 (5xz0 A:2-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398780Protein automated matches [226992] (2 species)
    not a true protein
  7. 2398785Species Staphylococcus aureus [TaxId:93062] [341138] (1 PDB entry)
  8. 2398786Domain d5xz0a1: 5xz0 A:2-121 [341139]
    Other proteins in same PDB: d5xz0a2, d5xz0b2
    automated match to d4rgos1
    mutant

Details for d5xz0a1

PDB Entry: 5xz0 (more details), 3 Å

PDB Description: staphylococcal enterotoxin b (seb) mutant s19 - n23a, y90a, r110a and f177a
PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d5xz0a1:

Sequence, based on SEQRES records: (download)

>d5xz0a1 b.40.2.2 (A:2-121) automated matches {Staphylococcus aureus [TaxId: 93062]}
sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyayqcyfskktndinshqtdkaktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d5xz0a1 b.40.2.2 (A:2-121) automated matches {Staphylococcus aureus [TaxId: 93062]}
sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyayqcydkaktcmyggvteh

SCOPe Domain Coordinates for d5xz0a1:

Click to download the PDB-style file with coordinates for d5xz0a1.
(The format of our PDB-style files is described here.)

Timeline for d5xz0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xz0a2