Lineage for d6amsb2 (6ams B:118-245)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2216175Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2216176Protein automated matches [226907] (20 species)
    not a true protein
  7. 2216318Species Pseudomonas aeruginosa [TaxId:208964] [340922] (1 PDB entry)
  8. 2216323Domain d6amsb2: 6ams B:118-245 [341136]
    automated match to d4tr8a2
    complexed with po4

Details for d6amsb2

PDB Entry: 6ams (more details), 2.39 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from pseudomonas aeruginosa
PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6amsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amsb2 d.131.1.0 (B:118-245) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tveegpgslnfsiaqsklrrlidrtsfamaqqdvryylngmllevnggtlrsvatdghrl
amcsldaqipsqdrhqvivprkgilelarllteqdgevgivlgqhhirattgeftftskl
vdgkfpdy

SCOPe Domain Coordinates for d6amsb2:

Click to download the PDB-style file with coordinates for d6amsb2.
(The format of our PDB-style files is described here.)

Timeline for d6amsb2: