Lineage for d1upud_ (1upu D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183128Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 183129Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 183130Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 183236Protein Uracil PRTase [53293] (3 species)
  7. 183244Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries)
  8. 183264Domain d1upud_: 1upu D: [34113]

Details for d1upud_

PDB Entry: 1upu (more details), 2.5 Å

PDB Description: structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)

SCOP Domain Sequences for d1upud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upud_ c.61.1.1 (D:) Uracil PRTase {Toxoplasma gondii}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

SCOP Domain Coordinates for d1upud_:

Click to download the PDB-style file with coordinates for d1upud_.
(The format of our PDB-style files is described here.)

Timeline for d1upud_: