Lineage for d5tqpa2 (5tqp A:150-839)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334663Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2334664Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2334665Family a.119.1.1: Plant lipoxigenases [48485] (2 proteins)
    automatically mapped to Pfam PF00305
  6. 2334666Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 2334667Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (22 PDB entries)
  8. 2334685Domain d5tqpa2: 5tqp A:150-839 [341124]
    Other proteins in same PDB: d5tqpa1, d5tqpb1
    automated match to d1f8na1
    complexed with fe; mutant

Details for d5tqpa2

PDB Entry: 5tqp (more details), 1.7 Å

PDB Description: lipoxygenase-1 (soybean) i553g mutant at 300k
PDB Compounds: (A:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5tqpa2:

Sequence, based on SEQRES records: (download)

>d5tqpa2 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangigettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

Sequence, based on observed residues (ATOM records): (download)

>d5tqpa2 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfviathr
hlsvlhpiyklltphyrnnmninalarqslinangigettflpskysvemssavyknwvf
tdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyyard
ddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaavnfg
qypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvieilst
hasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpvqlp
ytllypsseegltfrgipnsisi

SCOPe Domain Coordinates for d5tqpa2:

Click to download the PDB-style file with coordinates for d5tqpa2.
(The format of our PDB-style files is described here.)

Timeline for d5tqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tqpa1