Lineage for d5tqpa1 (5tqp A:6-149)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773710Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2773711Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2773712Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 2773716Protein Plant lipoxigenase [49725] (2 species)
  7. 2773717Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)
  8. 2773735Domain d5tqpa1: 5tqp A:6-149 [341123]
    Other proteins in same PDB: d5tqpa2, d5tqpb2
    automated match to d1ygea2
    complexed with fe; mutant

Details for d5tqpa1

PDB Entry: 5tqp (more details), 1.7 Å

PDB Description: lipoxygenase-1 (soybean) i553g mutant at 300k
PDB Compounds: (A:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5tqpa1:

Sequence, based on SEQRES records: (download)

>d5tqpa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d5tqpa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevavdnlnaflgrsvslqlisatkadahgkgkvgkdtflegints
lptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnsw
vyntklyksvriffanhty

SCOPe Domain Coordinates for d5tqpa1:

Click to download the PDB-style file with coordinates for d5tqpa1.
(The format of our PDB-style files is described here.)

Timeline for d5tqpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tqpa2