Lineage for d5wkia1 (5wki A:6-183)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2506506Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2506530Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (15 PDB entries)
  8. 2506544Domain d5wkia1: 5wki A:6-183 [341121]
    Other proteins in same PDB: d5wkia2, d5wkib_, d5wkid1, d5wkid2, d5wkie1, d5wkie2
    automated match to d3l9ra1
    complexed with act, cl, cuy, d3d, edo, fuc, na, nag

Details for d5wkia1

PDB Entry: 5wki (more details), 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkia1:

Sequence, based on SEQRES records: (download)

>d5wkia1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
gptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevae
leeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldfls
vknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Sequence, based on observed residues (ATOM records): (download)

>d5wkia1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
gptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevae
leeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsaivsflrgalggldflsvk
nascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5wkia1:

Click to download the PDB-style file with coordinates for d5wkia1.
(The format of our PDB-style files is described here.)

Timeline for d5wkia1: