SCOPe 2.05: Domain d1upub_: 1upu B:

Lineage for d1upub_ (1upu B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries)

8. Domain d1upub_: 1upu B: [34111]
   complexed with po4, u5p; mutant

Details for d1upub_

PDB Entry: 1upu, 2.5 Å

PDB Description: structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)

PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1upub_:

Sequence; same for both SEQRES and ATOM records:

>d1upub_ c.61.1.1 (B:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]}
qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm

Timeline for d1upub_:

• d1upub_ first appeared (with stable ids) in SCOP 1.55
  
• d1upub_ appears in SCOPe 2.04
  
• d1upub_ appears in SCOPe 2.06
  
• d1upub_ appears in the current release, SCOPe 2.08