![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5wkga2: 5wkg A:184-278 [341098] Other proteins in same PDB: d5wkga1, d5wkga3, d5wkgb_ automated match to d3l9ra2 complexed with cl, cuy, d21, edo, iod, na, nag, peg |
PDB Entry: 5wkg (more details), 2.06 Å
SCOPe Domain Sequences for d5wkga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wkga2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw ylratldvadgeaaglscrvkhsslegqdiilywr
Timeline for d5wkga2: