Lineage for d5wkga1 (5wkg A:4-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937580Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)
  8. 2937588Domain d5wkga1: 5wkg A:4-183 [341097]
    Other proteins in same PDB: d5wkga2, d5wkga3, d5wkgb_
    automated match to d3l9ra1
    complexed with cl, cuy, d21, edo, iod, na, nag, peg

Details for d5wkga1

PDB Entry: 5wkg (more details), 2.06 Å

PDB Description: crystal structure of human cd1b in complex with pa
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wkga1 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5wkga1:

Click to download the PDB-style file with coordinates for d5wkga1.
(The format of our PDB-style files is described here.)

Timeline for d5wkga1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wkgb_