SCOPe 2.08: Domain d5xjfa1: 5xjf A:230-339

Lineage for d5xjfa1 (5xjf A:230-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5xjfa1: 5xjf A:230-339 [341086]
   Other proteins in same PDB: d5xjfc1, d5xjfc2
   automated match to d1hzhk3
   complexed with cl, nag; mutant

Details for d5xjfa1

PDB Entry: 5xjf, 2.5 Å

PDB Description: crystal structure of fucosylated igg fc y296w mutant complexed with bis-glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (A:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5xjfa1:

Sequence; same for both SEQRES and ATOM records:

>d5xjfa1 b.1.1.2 (A:230-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
kpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5xjfa1:

• d5xjfa1 first appeared in SCOPe 2.06
  
• d5xjfa1 appears in SCOPe 2.07